PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 482aa    MW: 54797.4 Da    PI: 5.8498
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001932.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.7e-18215261148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++v+q+G + W+ Ia++++ gR +kqc++rw+++l
      Pbr001932.1 215 KGQWTIEEDRLLIQLVEQFGVRKWSHIAQMLP-GRIGKQCRERWHNHL 261
                      799*****************************.*************97 PP

2Myb_DNA-binding58.21.9e-18267309145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd++l++a+++ G++ W+ Ia++++ gRt++++k++w+
      Pbr001932.1 267 KDTWSEEEDKILIQAHAEIGNK-WAEIAKRLP-GRTENSIKNHWN 309
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.446210265IPR017930Myb domain
SuperFamilySSF466893.02E-32212308IPR009057Homeodomain-like
SMARTSM007171.6E-16214263IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-26216266IPR009057Homeodomain-like
CDDcd001671.56E-15218261No hitNo description
PfamPF139211.8E-18218275No hitNo description
SMARTSM007178.9E-18266314IPR001005SANT/Myb domain
PROSITE profilePS5129422.269266316IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-22267314IPR009057Homeodomain-like
CDDcd001679.12E-14269312No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MELNNLRENL VSQIHIPLLT SENYVKPCTT KDEFLFEGSS SSRGNYNYLQ DFHHLDHQFQ  60
VNVSSSNPMF GTHSPCFDPY NDTCYPYDQN SSHQDVNFYE CKPLNVAENN GAHGQVLDNF  120
QGGSYLKFST HDRSSNPLDH VVGTSFHMTA TNFLPLDCSQ DIKPVNFLVP DEVSCINNAD  180
QNAYYRKFGM NGKSRVTGIT RGSTVEGRKK SNVVKGQWTI EEDRLLIQLV EQFGVRKWSH  240
IAQMLPGRIG KQCRERWHNH LRPDIKKDTW SEEEDKILIQ AHAEIGNKWA EIAKRLPGRT  300
ENSIKNHWNA TKRRQYSKRK CRSKYARSSV LQEYIKSLNL DSASNSTGRQ RKNSSANNNG  360
VSTSTKAAAA AHQPQTNLEF SSANDQLVPS YNDFNEDPNF CFDENIFEEG CSIDSLLDDI  420
PCAPDVGEKN SNFDGKNQID YGNVDKGNFD EKDFDVEVQV DWESNEVKKE MDLVEMISQV  480
N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-462133152104C-Myb DNA-Binding Domain
1mse_C5e-462133152104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363046.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-101MYB98_ARATH; Transcription factor MYB98
TrEMBLM5WSR40.0M5WSR4_PRUPE; Uncharacterized protein
STRINGGLYMA05G02300.21e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-102myb domain protein 98